PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000417G1130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GATA
Protein Properties Length: 316aa    MW: 35709.5 Da    PI: 8.7341
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000417G1130genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA41.32.2e-13163195132
             GATA   1 CsnCgttkTplWRrgp.dgnktLCnaCGlyyrk 32 
                      Cs C + +Tp+WRr++ +g+k+LCnaCGl+ + 
  PH01000417G1130 163 CSRCLSNQTPQWRRDGpSGPKKLCNACGLRLKA 195
                      **************766************9985 PP

2GATA54.12.1e-17245279135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  PH01000417G1130 245 CTHCMSYKTPQWRAGPLGPKTLCNACGVRFKSGRL 279
                      *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.7E-10157211IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.57E-9157201No hitNo description
PROSITE profilePS5011412.413157194IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.6E-11161195IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.33E-9162194No hitNo description
PfamPF003201.6E-11163194IPR000679Zinc finger, GATA-type
SMARTSM004012.4E-14239293IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.121239275IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-14243303No hitNo description
Gene3DG3DSA:3.30.50.104.8E-13244277IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.79E-11244291No hitNo description
PfamPF003204.0E-15245279IPR000679Zinc finger, GATA-type
PROSITE patternPS003440245270IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MDVHPPNAAA SSPLGDLFPH EPAMESEDSS VEWLSIYVED CLSSSASYTN PVFAEQAPTT  60
MTNQNAARPK LPPPSSSNSR RKKRSLASVI SEDDDQHYFT LFVEPPLLLL DQKHWLAESE  120
LILPKKDRDQ ELVQQQEREQ EEEKKCKMSA GMQFQQEQPV RRCSRCLSNQ TPQWRRDGPS  180
GPKKLCNACG LRLKAGNGFT TISKNRCGQE IDKEQEQGKR QDKKKIKKIA YVNEELPPEE  240
PVKRCTHCMS YKTPQWRAGP LGPKTLCNAC GVRFKSGRLL PEYRPANSPT FVSYMHSNSH  300
KKVMQLRQAV AHSDK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618342.11e-150PREDICTED: uncharacterized protein LOC4352838
TrEMBLA0A0E0MPT11e-158A0A0E0MPT1_ORYPU; Uncharacterized protein
STRINGBGIOSGA037833-PA1e-150(Oryza sativa Indica Group)
STRINGLOC_Os12g42970.11e-150(Oryza sativa Japonica Group)
STRINGORGLA12G0166900.11e-150(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.11e-34GATA transcription factor 2